.
The Open Protein Structure Annotation Network
PDB Keyword
.

1wyz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of the putative methyltransferase from Bacteroides thetaiotaomicron VPI-5482 at the resolution 2.5 A. Norteast Structural Genomics Consortium target Btr28. To be Published
    Site NESGC
    PDB Id 1wyz Target Id BtR28
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS8779,PF00590 Molecular Weight 26098.88 Da.
    Residues 234 Isoelectric Point 7.64
    Sequence metalyllpvtlgdtpleqvlpsynteiirgirhfivedvrsarrflkkvdreididsltfyplnkhts pedisgylkplaggasmgviseagcpavadpgadvvaiaqrqklkviplvgpssiilsvmasgfngqsf afhgylpiepgerakklktleqrvyaesqtqlfietpyrnhkmiedilqncrpqtklciaanitcegef iqtrtvkdwkghipelskipcifllyk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.293
    Matthews' coefficent 2.20 Rfactor 0.226
    Waters 126 Solvent Content 43.70

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1wyz
    1. Strategies for high_throughput comparative modeling: Applications to leverage analysis in structural genomics and protein family organization
    N Mirkovic, Z Li, A Parnassa - : Structure, Function, and , 2007 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch