.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x9b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of hypothetical membrane protein ta0354_69_121 from Thermoplasma acidophilum. To be Published
    Site NESGC
    PDB Id 1x9b Target Id TaT38
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS9217,1.20.58.290, 6291, PF11433 Molecular Weight 14128.80 Da.
    Residues 121 Isoelectric Point 9.52
    Sequence mersirdyqfiiyaivfvasfsvliivsnqllfhnafldtaafdvgnwvywifavsfiftitmaylmvr nlsdrakfesminspsksvfvrnlnelealavrlgksyriqldqakekwkvk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1x9b
    1. Physics-based protein-structure prediction using a hierarchical protocol based on the UNRES force field: Assessment in two blind tests
    S O_dziej, C Czaplewski, A Liwo - Proceedings of the , 2005 - National Acad Sciences
     
    2. Domain definition and target classification for CASP6
    M Tress, CH Tai, G Wang, I Ezkurdia - PROTEINS: , 2005 - Wiley Online Library
     
    3. Iterative assembly of helical proteins by optimal hydrophobic packing
    GA Wu, EA Coutsias, KA Dill - Structure, 2008 - Elsevier
     
    4. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    5. Exact Energy Landscapes of Proteins Using a Coarse-Grained Model
    F Dressel, S Kobe - Rugged Free Energy Landscapes, 2008 - Springer
     
    6. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     
    7. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    8. Experiment planning for protein structure elucidation and site-directed protein recombination
    X Ye - 2007 - cs.dartmouth.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch