.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xbf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-RAY STRUCTURE NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET CAR10 FROM C. ACETOBUTYLICUM. To be published
    Site NESGC
    PDB Id 1xbf Target Id CaR10
    Molecular Characteristics
    Source Clostridium acetobutylicum
    Alias Ids TPS8785,2.60.120.460, PF01894 Molecular Weight 14594.90 Da.
    Residues 132 Isoelectric Point 5.75
    Sequence mkgvieyslktsnddqfiditnlvkkavdesgvsdgmavvfcphttagitinenadpdvtrdilvnldk vfpkvgdykhvegnshahikaslmgssqqiiiengklklgtwqgiyftefdgprdrkvfvkii
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.248
    Matthews' coefficent 1.98 Rfactor 0.203
    Waters 140 Solvent Content 38.00

    Ligand Information
    Ligands SO4 (SULFATE) x 5
    Metals

    Jmol

     
    Google Scholar output for 1xbf
    1. On the combination of molecular replacement and single-wavelength anomalous diffraction phasing for automated structure determination
    S Panjikar, V Parthasarathy, VS Lamzin - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Sensitive genome-wide screen for low secondary enzymatic activities: the YjbQ family shows thiamin phosphate synthase activity
    E Morett, G Saab-Rincn, L Olvera, M Olvera - Journal of molecular , 2008 - Elsevier
     
    3. Crystal structure of the hypothetical protein ST2072 from Sulfolobus tokodaii
    Y Tanaka, K Tsumoto, E Tanabe - Proteins: Structure, , 2005 - Wiley Online Library
     
    4. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch