.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xfs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the hypothetical Protein from Nitrosomonas europaea, NESG Target NeR5. To be Published
    Site NESGC
    PDB Id 1xfs Target Id NeR5
    Molecular Characteristics
    Source Nitrosomonas europaea
    Alias Ids TPS8983,3.30.530.20, PF08327 Molecular Weight 19281.16 Da.
    Residues 170 Isoelectric Point 5.61
    Sequence msttpidaeldlmlkrelavpvnlvwrgltepellkkwfvpkpwsisdcrvdlrpggefytvmqdpegn kfpnsgcflevtdekrliwtsalvknyrpavpattsdkecahivmtavielqptssgtrytacamhntp gqrklheemgfhegwgttitqleellkqekay
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.255
    Matthews' coefficent 2.55 Rfactor 0.221
    Waters 342 Solvent Content 50.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xfs
    1. The Bet v 1 fold: an ancient, versatile scaffold for binding of large, hydrophobic ligands
    C Radauer, P Lackner - BMC evolutionary biology, 2008 - biomedcentral.com
     
    2. Structural insight into the self-sacrifice mechanism of enediyne resistance
    S Singh, MH Hager, C Zhang, BR Griffith, MS Lee - 2006 - ACS Publications
     
    3. Efficient protein tertiary structure retrievals and classifications using content based comparison algorithms
    PH Chi - 2007 - mospace.umsystem.edu
     
    4. High-throughput computational structure-based characterization of protein families: START domains and implications for structural genomics
    H Lee, Z Li, A Silkov, M Fischer, D Petrey - Journal of structural and , 2010 - Springer
     
    5. Target highlights in CASP9: experimental target structures for the critical assessment of techniques for protein structure prediction
    A Kryshtafovych, J Moult, SG Bartual - Proteins: Structure, , 2011 - Wiley Online Library
     
    6. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch