.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xhj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure Of The Staphylococcus Epidermidis Protein SE0630. Northest Strucutral Genomics Consortium Target SeR8. To be Published
    Site NESGC
    PDB Id 1xhj Target Id SeR8
    Molecular Characteristics
    Source Staphylococcus epidermidis
    Alias Ids TPS9124,PF01106 Molecular Weight 8735.56 Da.
    Residues 80 Isoelectric Point 4.45
    Sequence mptenptmfdqvaevierlrpfllrdggdctlvdvedgivklqlhgacgtcpsstitlkagieralhee vpgvieveqvf
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xhj
    1. Iron_ Sulfur Cluster Biosynthesis: Functional Characterization of the N-and C-Terminal Domains of Human NFU
    Y Liu, W Qi, JA Cowan - Biochemistry, 2009 - ACS Publications
     
    2. Superimposition of protein structures with dynamically weighted RMSD
    D Wu, Z Wu - Journal of Molecular Modeling, 2010 - Springer
     
    3. SPINS: a laboratory information management system for organizing and archiving intermediate and final results from NMR protein structure determinations
    MC Baran, HNB Moseley, JM Aramini - Proteins: Structure, , 2006 - Wiley Online Library
     
    4. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch