.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xhs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of Escherichia coli ytfP expands the structural coverage of the UPF0131 protein domain family. Proteins 68 789-795 2007
    Site NESGC
    PDB Id 1xhs Target Id ER111
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8821,3.10.490.10, PF06094, 6448 Molecular Weight 12865.79 Da.
    Residues 113 Isoelectric Point 6.39
    Sequence mrifvygslrhkqgnshwmtnaqllgdfsidnyqlyslghypgavpgngtvhgevyridnatlaeldal rtrggeyarqliqtpygsawmyvyqrpvdglkliesgdwldrdk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xhs
    1. Biosynthesis of butirosin: transfer and deprotection of the unique amino acid side chain
    NM Llewellyn, Y Li, JB Spencer - Chemistry & biology, 2007 - Elsevier
     
    2. SPINS: a laboratory information management system for organizing and archiving intermediate and final results from NMR protein structure determinations
    MC Baran, HNB Moseley, JM Aramini - Proteins: Structure, , 2006 - Wiley Online Library
     
    3. Solution structure of Arabidopsis thaliana protein At5g39720. 1, a member of the AIG2-like protein family
    BL Lytle, FC Peterson, EM Tyler, CL Newman - Section F: Structural , 2006 - iucr.org
     
    4. Crystal structure of a conserved hypothetical protein (gi: 13879369) from Mouse at 1.90 resolution reveals a new fold
    HE Klock, R Schwarzenbacher, Q Xu - Proteins: Structure, , 2005 - Wiley Online Library
     
    5. Solution NMR structure of Escherichia coli ytfP expands the structural coverage of the UPF0131 protein domain family
    JM Aramini, YJ Huang, GVT Swapna - Proteins: Structure, , 2007 - Wiley Online Library
     
    6. Solution structure of At3g28950 from Arabidopsis thaliana
    NB de la Cruz, FC Peterson - : Structure, Function, and , 2008 - Wiley Online Library
     
    7. Identification and Characterization of _-Glutamylamine Cyclotransferase, an Enzyme Responsible for _-Glutamyl-_-lysine Catabolism
    AJ Oakley, M Coggan, PG Board - Journal of Biological Chemistry, 2010 - ASBMB
     
    8. Crystal structure of Homo sapiens protein LOC79017
    E Bae, CA Bingman, DJ Aceti - Structure, Function, and , 2008 - Wiley Online Library
     
    9. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    10. Nuclear Magnetic Resonance Affinity Screening Methods for Functional Annotation of Proteins and Drug Discovery
    D Matthew - 2010 - digitalcommons.unl.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch