.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xjs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of Iron-Sulfur cluster assembly protein IscUfrom Bacillus subtilis, with Zinc bound at the active site.Northeast Structural Genomics Consortium Target SR17. To be Published
    Site NESGC
    PDB Id 1xjs Target Id SR17
    Related PDB Ids 2azh 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9069,3.90.1010.10, 6362, PF01592 Molecular Weight 16165.59 Da.
    Residues 147 Isoelectric Point 4.91
    Sequence msfnanldtlyrqvimdhyknprnkgvlndsivvdmnnptcgdrirltmkldgdivedakfegegcsis masasmmtqaikgkdietalsmskifsdmmqgkeyddsidlgdiealqgvskfparikcatlswkalek gvakeeggn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 1xjs
    1. Structural basis for FeS cluster assembly and tRNA thiolation mediated by IscS proteinprotein interactions
    R Shi, A Proteau, M Villarroya, I Moukadiri, L Zhang - PLoS biology, 2010 - dx.plos.org
     
    2. Structural, mechanistic and coordination chemistry of relevance to the biosynthesis of ironsulfur and related iron cofactors
    W Qi, JA Cowan - Coordination Chemistry Reviews, 2011 - Elsevier
     
    3. Expression, crystallization and preliminary crystallographic analysis of SufE (XAC2355) from Xanthomonas axonopodis pv. citri
    CR Guzzo, LR Silva, LMP Galvo-Botton - Section F: Structural , 2006 - scripts.iucr.org
     
    4. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch