.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xkl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and biochemical studies identify tobacco SABP2 as a methyl salicylate esterase and implicate it in plant innate immunity. Proc.Natl.Acad.Sci.USA 102 1773-1778 2005
    Site NESGC
    PDB Id 1xkl Target Id AR2241
    Related PDB Ids 1y7i 1y7h 
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS8722,PF00561, 3.40.50.1820 Molecular Weight 29302.22 Da.
    Residues 260 Isoelectric Point 5.39
    Sequence mkegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlplmelmesl sadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleqynertpaenwldtqflp ygspeepltsmffgpkflahklyqlcspedlalasslvrpsslfmedlskakyftderfgsvkrvyivc tedkgipeefqrwqidnigvteaieikgadhmamlcepqklcaslleiahkyn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.234
    Matthews' coefficent 2.10 Rfactor 0.19
    Waters 926 Solvent Content 41.00

    Ligand Information
    Ligands STH (2-AMINO-4H-1,3-BENZOXATHIIN-4-OL) x 4
    Metals

    Jmol

     
    Google Scholar output for 1xkl
    1. Strategies for high_throughput comparative modeling: Applications to leverage analysis in structural genomics and protein family organization
    N Mirkovic, Z Li, A Parnassa - : Structure, Function, and , 2007 - Wiley Online Library
     
    2. Structural biology in plant natural product biosynthesisarchitecture of enzymes from monoterpenoid indole and tropane alkaloid biosynthesis
    J Stckigt, S Panjikar - Nat. Prod. Rep., 2007 - xlink.rsc.org
     
    3. Functional insights from structural genomics
    F Forouhar, A Kuzin, J Seetharaman, I Lee - Journal of structural and , 2007 - Springer
     
    4. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    5. Homology modeling and molecular dynamics studies on the tomato methyl jasmonate esterase
    WW Han, ZS Li, QC Zheng, C Sun - Polymer, 2006 - Elsevier
     
    6. Features of homotetrameric molecular association in protein crystals
    UV Katre, CG Suresh - Acta Crystallographica Section D: Biological , 2008 - scripts.iucr.org
     
    7. Hydroxynitrile Lyases with _/__Hydrolase Fold: Two Enzymes with Almost Identical 3D Structures but Opposite Enantioselectivities and Different Reaction
    JN Andexer, N Staunig, T Eggert, C Kratky - , 2012 - Wiley Online Library
     
    8. The crystal structure of the R-selective hydroxynitrile lyase from Arabidopsis thaliana
    J Andexer, N Staunig, T Eggert - DIE ERSTE R- , 2007 - docserv.uni-duesseldorf.de
     
    9. Natural products reports review on alkaloid biosynthesis the impact of structural biology on alkaloid biosynthesis research
    S Panjikar, J Stoeckigt, S O'Connor - Natural Product , 2012 - pubs.rsc.org
     
    10. Charakterisierung zentraler Enzyme des Ajmalin-Biosynthesewegs aus Rauvolfia serpentina
    M Hill - 2007 - ubm.opus.hbz-nrw.de
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch