.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xkn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative Peptidyl-arginine Deiminase from Chlorobium tepidum, NESG Target CtR21. To be Published
    Site NESGC
    PDB Id 1xkn Target Id CtR21
    Molecular Characteristics
    Source Chlorobium tepidum
    Alias Ids TPS8804,3.75.10.10, PF04371 Molecular Weight 39146.24 Da.
    Residues 347 Isoelectric Point 4.70
    Sequence mseptyfmppewaphastwlswphkleswpgkfepvpavfaelayqlsrsetvninvlddameaqarel lkerdpegkyaerivfhriptndawcrdhgpnyvirtqdgrrdkvimnweynawggkyepydddnavpe rvakaqglpmvstgmvleggaidvngagllltttacllnpnrnpslgkaeieaqlrrylgiekvlwlgd giagddtdghvddmarfvnentvviaveedpedenykplrenyellktmtgldgkplnivklpmpepvy ydgerlpasyanfyiantvvlvptyrcprdqqaidilqqcfpkrevvgidcsdliwglgaihcvtheepam
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.196
    Matthews' coefficent 2.20 Rfactor 0.18
    Waters 601 Solvent Content 44.00

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1;NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 1xkn
    1. The guanidino_group modifying enzymes: Structural basis for their diversity and commonality
    H Shirai, Y Mokrab, K Mizuguchi - Proteins: Structure, Function, , 2006 - Wiley Online Library
     
    2. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    3. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     
    4. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    5. Applications of Structural Bioinformatics for the Structural Genomics Era
    M Novotny - 2007 - uu.diva-portal.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch