.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xm3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Northeast Structural Genomics Target SR156. To be Published
    Site NESGC
    PDB Id 1xm3 Target Id SR156
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9067,PF05690, 3.20.20.70 Molecular Weight 27020.63 Da.
    Residues 256 Isoelectric Point 4.91
    Sequence msmltiggksfqsrlllgtgkypsfdiqkeavavsesdiltfavrrmnifeasqpnfleqldlskytll pntagastaeeavriarlakasglcdmikvevigcsrsllpdpvetlkaseqlleegfivlpytsddvv larkleelgvhaimpgaspigsgqgilnplnlsfiieqakvpvivdagigspkdaayamelgadgvlln tavsgaddpvkmaramklaveagrlsyeagriplkqygtasspgeglpv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.237
    Matthews' coefficent 2.70 Rfactor 0.212
    Waters 630 Solvent Content 40.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xm3
    1. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch