.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xn7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of E.Coli Protein yhgG: The Northeast Structural Genomics Consortium Target ET95. To be Published
    Site NESGC
    PDB Id 1xn7 Target Id ET95
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8878,PF01978, PF09012, 6367, 1.10.10.10 Molecular Weight 8659.66 Da.
    Residues 78 Isoelectric Point 7.65
    Sequence masliqvrdllalrgrmeaaqisqtlntpqpminamlqqlesmgkavriqeepdgclsgsckscpegka clrewwalr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xn7
    1. Feotransport of ferrous iron into bacteria
    ML Cartron, S Maddocks, P Gillingham, CJ Craven - Biometals, 2006 - Springer
     
    2. Protein backbone chemical shifts predicted from searching a database for torsion angle and sequence homology
    Y Shen, A Bax - Journal of biomolecular NMR, 2007 - Springer
     
    3. NMR data collection and analysis protocol for high-throughput protein structure determination
    G Liu, Y Shen, HS Atreya, D Parish - Proceedings of the , 2005 - National Acad Sciences
     
    4. PF0610, a novel winged helix-turn-helix variant possessing a rubredoxin-like Zn ribbon motif from the hyperthermophilic archaeon, Pyrococcus furiosus
    X Wang, HS Lee, J Frank, FE Jenney Jr - Biochemistry, 2007 - ACS Publications
     
    5. NMR structure note: the ferrous iron transport protein C (FeoC) from Klebsiella pneumoniae
    KW Hung, T Juan, Y Hsu, TH Huang - Journal of biomolecular NMR, 2012 - Springer
     
    6. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch