.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xn8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR data collection and analysis protocol for high-throughput protein structure determination. Proc.Natl.Acad.Sci.Usa 102 10487-10492 2005
    Site NESGC
    PDB Id 1xn8 Target Id SR215
    Related PDB Ids 1zts 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9076,1.10.3230.10, PF11436, 6366 Molecular Weight 14696.01 Da.
    Residues 131 Isoelectric Point 4.60
    Sequence mllitpdelksysvfesvktrpdellkqdileatadiilkvghdfsdaeyiplpetvrlallklsqfya lingdesiikgyttekigdysytlgdgsplqkpdvyalikdyvkpadpdlegieakvrmrsi
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xn8
    1. NMR data collection and analysis protocol for high-throughput protein structure determination
    G Liu, Y Shen, HS Atreya, D Parish - Proceedings of the , 2005 - National Acad Sciences
     
    2. Structure of bacteriophage SPP1 head-to-tail connection reveals mechanism for viral DNA gating
    S Lhuillier, M Gallopin, B Gilquin - Proceedings of the , 2009 - National Acad Sciences
     
    3. A common evolutionary origin for tailed-bacteriophage functional modules and bacterial machineries
    D Veesler, C Cambillau - Microbiology and Molecular Biology , 2011 - Am Soc Microbiol
     
    4. Genome gating in tailed bacteriophage capsids
    P Tavares, S Zinn-Justin, EV Orlova - Viral Molecular Machines, 2012 - Springer
     
    5. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch