.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xn9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of Methanosarcina mazei Protein RPS24E: The Northeast Structural Genomics Consortium Target MaR11. To be Published
    Site NESGC
    PDB Id 1xn9 Target Id MaR11
    Molecular Characteristics
    Source Methanosarcina mazei
    Alias Ids TPS8965,6368, PF01282, 3.30.70.330 Molecular Weight 11673.79 Da.
    Residues 101 Isoelectric Point 6.34
    Sequence mdikiikdkknpllnrreldfivkyegstpsrndvrnklaamlnaplellviqrikteygmqeskgyak lyedadrmkqveqeyvlkrnavpgsetegeea
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xn9
    1. Protein backbone chemical shifts predicted from searching a database for torsion angle and sequence homology
    Y Shen, A Bax - Journal of biomolecular NMR, 2007 - Springer
     
    2. NMR data collection and analysis protocol for high-throughput protein structure determination
    G Liu, Y Shen, HS Atreya, D Parish - Proceedings of the , 2005 - National Acad Sciences
     
    3. Mutation of ribosomal protein RPS24 in Diamond-Blackfan anemia results in a ribosome biogenesis disorder
    V Choesmel, S Fribourg - Human molecular , 2008 - Oxford Univ Press
     
    4. Comparisons of NMR spectral quality and success in crystallization demonstrate that NMR and X-ray crystallography are complementary methods for small protein
    DA Snyder, Y Chen, NG Denissova - Journal of the , 2005 - ACS Publications
     
    5. Solution structure of TA1092, a ribosomal protein S24e from Thermoplasma acidophilum
    BY Jeon, J Jung, DW Kim, A Yee - Proteins: Structure, , 2006 - Wiley Online Library
     
    6. The origin of a derived superkingdom: how a gram-positive bacterium crossed the desert to become an archaeon
    RE Valas, PE Bourne - Biology direct, 2011 - biomedcentral.com
     
    7. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch