.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xne

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR data collection and analysis protocol for high-throughput protein structure determination. Proc.Natl.Acad.Sci.Usa 102 10487-10492 2005
    Site NESGC
    PDB Id 1xne Target Id PfR14
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9016,3.10.480.10, PF04266, 6364 Molecular Weight 13787.64 Da.
    Residues 113 Isoelectric Point 9.72
    Sequence mkvyrlylkdeylemvksgkkrievrvaypqlkdikrgdkiifndlipaevvevkkyetfrqvlreepi dkifpdkpsfekalkrfhnmypkwkeyrygvlaikfrvlgrdke
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xne
    1. Protein backbone chemical shifts predicted from searching a database for torsion angle and sequence homology
    Y Shen, A Bax - Journal of biomolecular NMR, 2007 - Springer
     
    2. NMR data collection and analysis protocol for high-throughput protein structure determination
    G Liu, Y Shen, HS Atreya, D Parish - Proceedings of the , 2005 - National Acad Sciences
     
    3. The ASCH superfamily: novel domains with a fold related to the PUA domain and a potential role in RNA metabolism
    LM Iyer, AM Burroughs, L Aravind - Bioinformatics, 2006 - Oxford Univ Press
     
    4. Neural networks predict protein structure and function
    M Punta, B Rost - Methods Mol Biol, 2008 - Springer
     
    5. Structural genomics reveals EVE as a new ASCH/PUA_related domain
    C Bertonati, M Punta, M Fischer - Proteins: Structure, , 2009 - Wiley Online Library
     
    6. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    7. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     
    8. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch