.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xpn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of Pseudomonas aeruginosa protein PA1324. To be Published
    Site NESGC
    PDB Id 1xpn Target Id PaP1
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS9000,6343, 2.60.40.10 Molecular Weight 16317.13 Da.
    Residues 150 Isoelectric Point 5.09
    Sequence asnpndlpdfpeheyaatqqvgegvingdlyltsasgaiqkgtntkvtlepatsymkayyakfgnldaa krdpdvqppvldprratyvreattdqngrfdfdhipngtyyisseltwsaqsdgktiteggtvtklvtv sgsqpqkvlltr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xpn
    1. Structure and function of Pseudomonas aeruginosa protein PA1324 (21170)
    KA Mercier, JR Cort, MA Kennedy, EE Lockert - Protein , 2009 - Wiley Online Library
     
    2. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch