.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xpv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of Northeast Structural Genomics Target Protein XcR50 from X. Campestris. To be Published
    Site NESGC
    PDB Id 1xpv Target Id XcR50
    Related PDB Ids 1ttz 
    Molecular Characteristics
    Source Xanthomonas campestris
    Alias Ids TPS9257,PF05768, 3.40.30.10, 6363 Molecular Weight 8703.32 Da.
    Residues 78 Isoelectric Point 4.51
    Sequence maltlyqrddchlcdqavealaqaragaffsvfidddaalesayglrvpvlrdpmgreldwpfdaprlr awldaapha
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xpv
    1. NMR data collection and analysis protocol for high-throughput protein structure determination
    G Liu, Y Shen, HS Atreya, D Parish - Proceedings of the , 2005 - National Acad Sciences
     
    2. Pfam 10 years on: 10 000 families and still growing
    SJ Sammut, RD Finn, A Bateman - Briefings in bioinformatics, 2008 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch