.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xpw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Improving NMR protein structure quality by Rosetta refinement: a molecular replacement study. Proteins 75 147-167 2009
    Site NESGC
    PDB Id 1xpw Target Id HR1958
    Related PDB Ids 1tvg 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8908,6344, 2.60.120.260, PF00754 Molecular Weight 16296.48 Da.
    Residues 144 Isoelectric Point 4.93
    Sequence mrkidlclssegsevilatssdekhppeniidgnpetfwtttgmfpqefiicfhkhvrierlviqsyfv qtlkiekstskepvdfeqwiekdlvhtegqlqneeivahdgsatylrfiivsafdhfasvhsvsaegtv vsnlss
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xpw
    1. High-resolution structure prediction and the crystallographic phase problem
    B Qian, S Raman, R Das, P Bradley, AJ McCoy - Nature, 2007 - nature.com
     
    2. Domain definition and target classification for CASP6
    M Tress, CH Tai, G Wang, I Ezkurdia - PROTEINS: , 2005 - Wiley Online Library
     
    3. Improving NMR protein structure quality by Rosetta refinement: a molecular replacement study
    TA Ramelot, S Raman, AP Kuzin, R Xiao - Proteins: Structure, , 2009 - Wiley Online Library
     
    4. Computational modeling of laminin N_terminal domains using sparse distance constraints from disulfide bonds and chemical cross_linking
    S Kalkhof, S Haehn, M Paulsson - Proteins: Structure, , 2010 - Wiley Online Library
     
    5. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    6. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     
    7. Soft energy function and generic evolutionary method for discriminating native from nonnative protein conformations
    Y Chiu, J Hwang, J Yang - Journal of computational chemistry, 2008 - Wiley Online Library
     
    8. Determining Protein Structures from NOESY Distance Constraints by Semidefinite Programming
    B Alipanahi, N Krislock, A Ghodsi, H Wolkowicz - 2012 - hal.inria.fr
     
    9. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     
    10. Protein structure by semidefinite facial reduction
    B Alipanahi, N Krislock, A Ghodsi, H Wolkowicz - Research in , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch