.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xq4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative ApaA Protein from Bordetella pertussis, Northeast Structural Genomics Target BeR40. To be Published
    Site NESGC
    PDB Id 1xq4 Target Id BeR40
    Molecular Characteristics
    Source Bordetella pertussis
    Alias Ids TPS8754,PF04379, 2.60.40.1470 Molecular Weight 14608.86 Da.
    Residues 131 Isoelectric Point 5.75
    Sequence msnrerpvkpydltvsvtpryvpeqsdpsqqqyvfaytvritntgshpaqvisrhwiitdgeervqevr glgvvgqqpllapgetfeytsgcplptpigtmrgtyhcvgengipfevpiaefllamprtlh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.70 Rfree 0.286
    Matthews' coefficent 3.64 Rfactor 0.241
    Waters 306 Solvent Content 65.00

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 1xq4
    1. Solution structure of ApaG from Xanthomonas axonopodis pv. citri reveals a fibronectin_3 fold
    DO Cicero, GM Contessa, TA Pertinhez - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Improvements to the pseudospectral electronic structure method and experimental protein model initiation
    BH Greeley - 2006 - greeley.org
     
    3. MODELING PROTEIN INTERACTIONS THROUGH STRUCTURE ALIGNMENT
    R Sinha - 2011 - kuscholarworks.ku.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch