.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xqb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray Structure Of YaeB from Haemophilus influenzae. Northeast Structural Genomics Research Consortium (NESGC) target IR47. To be Published
    Site NESGC
    PDB Id 1xqb Target Id IR47
    Molecular Characteristics
    Source Haemophilus influenzae
    Alias Ids TPS8937,2.40.30.70, PF01980 Molecular Weight 27212.85 Da.
    Residues 239 Isoelectric Point 8.77
    Sequence mndltlspiaiihtpykekfsvprqpnlvedgvgivellppynspeavrgleqfshlwlifqfdqiqqg kwqptvrpprlggnqrvgvfasrathrpnplglskvelrqvecingniflhlgavdlvdgtpifdikpy iayadsepnaqssfaqeklpvkltvefteqaksavkkreekrphlsrfirqvleqdprpayqqgkpsdr iygmslyefnvkwrikagtvncvevieiekdk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.85 Rfree 0.324
    Matthews' coefficent 2.56 Rfactor 0.279
    Waters 68 Solvent Content 51.97

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xqb
    1. Assessment of CASP6 predictions for new and nearly new fold targets
    JJ Vincent, CH Tai - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    2. Domain definition and target classification for CASP6
    M Tress, CH Tai, G Wang, I Ezkurdia - PROTEINS: , 2005 - Wiley Online Library
     
    3. The prediction of protein function at CASP6
    S Soro, A Tramontano - Proteins: Structure, Function, and , 2005 - Wiley Online Library
     
    4. Cradle-loop barrels and the concept of metafolds in protein classification by natural descent
    V Alva, KK Koretke, M Coles, AN Lupas - Current opinion in structural , 2008 - Elsevier
     
    5. Structural characteristics of novel protein folds
    N Fernandez-Fuentes, JM Dybas, A Fiser - PLoS computational biology, 2010 - dx.plos.org
     
    6. Evaluation of the structural quality of modeled proteins by using globularity criteria
    S Costantini, AM Facchiano - BMC structural biology, 2007 - biomedcentral.com
     
    7. Prediction of protein domain boundaries from statistics of appearance of amino acid residues
    OV Galzitskaya, NV Dovidchenko, MY Lobanov - Molecular Biology, 2006 - Springer
     
    8. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    9. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch