.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xsq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ureidoglycolate hydrolase from E.coli. Northeast Structural Genomics Consortium target ET81. To be Published
    Site NESGC
    PDB Id 1xsq Target Id ET81
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8872,2.60.120.480, PF04115 Molecular Weight 18168.62 Da.
    Residues 160 Isoelectric Point 4.80
    Sequence mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdctlisinraqpanlpltih elerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhrnvwhhplfawqrvtdflt idrggsdncdvesipeqelcfa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.257
    Matthews' coefficent 2.20 Rfactor 0.227
    Waters 246 Solvent Content 44.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xsq
    1. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch