.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xsr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of Northeast Structural Genomics Consortium target SfR7. To be Published
    Site NESGC
    PDB Id 1xsr Target Id SfR7
    Molecular Characteristics
    Source Shigella flexneri
    Alias Ids TPS9132,2.60.120.480, PF04115 Molecular Weight 18221.67 Da.
    Residues 160 Isoelectric Point 4.90
    Sequence mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraqpanlpltih elerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhrnvwhhplfawqrvtdflt idrggsdncdvesipeqelcfa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.288
    Matthews' coefficent 2.53 Rfactor 0.223
    Waters 80 Solvent Content 51.29

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xsr
    1. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch