.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xto

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Coenzyme PQQ Synthesis Protein (PqqB) from Pseudomonas putida, Northeast Structural Genomics Target PpR6. To be Published
    Site NESGC
    PDB Id 1xto Target Id PpR6
    Molecular Characteristics
    Source Pseudomonas putida
    Alias Ids TPS9031,3.60.15.10 Molecular Weight 33329.14 Da.
    Residues 303 Isoelectric Point 5.43
    Sequence myiqvlgsaagggfpqwncncvnckgyrdgtlkatartqssialsddgvhwilcnaspdiraqlqafap mqparalrdtginaivlldsqidhttgllslregcphqvwctdmvhqdlttgfplfnmlshwngglqwn rielegsfvidacpnlkftpfplrsaappysphrfdphpgdnlglmvedtrtggklfyapglgqvdekl lammhgadcllvdgtlweddemqrrgvgtrtgremghlaqngpggmlevldgfprqrkvlihinntnpi ldensperaevlrrgvevafdgmsiel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.282
    Matthews' coefficent 3.10 Rfactor 0.227
    Waters 33 Solvent Content 59.00

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 1xto
    1. Novel leverage of structural genomics
    J Liu, GT Montelione, B Rost - Nature biotechnology, 2007 - nature.com
     
    2. The pyrroloquinoline quinone biosynthesis pathway revisited: a structural approach
    S Puehringer, M Metlitzky - BMC , 2008 - biomedcentral.com
     
    3. Xanthomonas campestris PqqD in the pyrroloquinoline quinone biosynthesis operon adopts a novel saddle_like fold that possibly serves as a PQQ carrier
    TY Tsai, CY Yang, HL Shih, AHJ Wang - Proteins: Structure, , 2009 - Wiley Online Library
     
    4. Crystal structure of PqqB from Pseudomonas putida at 2.2 resolution
    M Metlitzky, S Puehringer, SJ Fisher - Journal of Biophysical Chemistry, 2012 - scirp.org
     
    5. Toward the structure and function of carbon-phosphorus lyase enzymes
    SM He - 2008 - qspace.library.queensu.ca
     
    6. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch