.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xw8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of putative lactam utilization protein YBGL. Northeast Structural Genomics Consortium target ET90. To be Published
    Site NESGC
    PDB Id 1xw8 Target Id ET90
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8874,PF03746 Molecular Weight 25798.89 Da.
    Residues 244 Isoelectric Point 5.80
    Sequence mkidlnadlgegcasdaelltlvssaniacgfhagdaqimqacvreaikngvaigahpsfpdrenfgrs amqlppetvyaqtlyqigalatiaraqggvmrhvkphgmlynqaakeaqladaiaravyacdpalilvg lagseliragkqyglttreevfadrgyqadgslvprsqsgalieneeqalaqtlemvqhgrvksitgew atvaaqtvclhgdgehalafarrlrsafaekgivvaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.265
    Matthews' coefficent 2.10 Rfactor 0.241
    Waters 59 Solvent Content 42.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1xw8
    1. Crystal structure of the YdjC-family protein TTHB029 from Thermus thermophilus HB8: Structural relationship with peptidoglycan N-acetylglucosamine deacetylase
    T Imagawa, H Iino, M Kanagawa, A Ebihara - Biochemical and , 2008 - Elsevier
     
    2. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch