.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xx6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of Clostridium acetobutylicum thymidine kinase with ADP. Northeast Structural Genomics Target CAR26. To be Published
    Site NESGC
    PDB Id 1xx6 Target Id CaR26
    Molecular Characteristics
    Source Clostridium acetobutylicum
    Alias Ids TPS8787,3.40.50.300, PF00265 Molecular Weight 22301.72 Da.
    Residues 195 Isoelectric Point 6.35
    Sequence myrpkdhgwvevivgpmysgkseelirrirrakiakqkiqvfkpeidnryskedvvshmgekeqavaik nsreilkyfeedteviaidevqffddeiveivnkiaesgrrvicagldmdfrgkpfgpipelmaiaefv dkiqaicvvcgnpatrtqrlingkpafyddpvvligamesyearcrkchvvpqkkev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.266
    Matthews' coefficent 1.95 Rfactor 0.241
    Waters 171 Solvent Content 37.00

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 2
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 1xx6
    1. Comparisons of NMR spectral quality and success in crystallization demonstrate that NMR and X-ray crystallography are complementary methods for small protein
    DA Snyder, Y Chen, NG Denissova - Journal of the , 2005 - ACS Publications
     
    2. Structure of the substrate complex of thymidine kinase from Ureaplasma urealyticum and investigations of possible drug targets for the enzyme
    U Kosinska, C Carnrot, S Eriksson, L Wang - FEBS , 2005 - Wiley Online Library
     
    3. Selective phosphorylation of antiviral drugs by vaccinia virus thymidine kinase
    MN Prichard, KA Keith, MP Johnson - Antimicrobial agents , 2007 - Am Soc Microbiol
     
    4. Binding of ATP to TK1-like enzymes is associated with a conformational change in the quaternary structure
    D Segura-Pea, S Lutz, C Monnerjahn - Journal of molecular , 2007 - Elsevier
     
    5. Preparation and Biological Evaluation of 10B-Enriched 3-[5-{2-(2, 3-Dihydroxyprop-1-yl)-o-carboran-1-yl} pentan-1-yl] thymidine (N5-2OH), a New Boron Delivery
    Y Byun, BTS Thirumamagal, W Yang - Journal of medicinal , 2006 - ACS Publications
     
    6. Synthesis, In Vitro, and In Silico Evaluation of Organometallic Technetium and Rhenium Thymidine Complexes with Retained Substrate Activity toward Human
    D Desbouis, H Struthers, V Spiwok - Journal of medicinal , 2008 - ACS Publications
     
    7. Conformational changes in redox pairs of protein structures
    SW Fan, RA George, NL Haworth, LL Feng - Protein , 2009 - Wiley Online Library
     
    8. Structural studies of thymidine kinases from Bacillus anthracis and Bacillus cereus provide insights into quaternary structure and conformational changes upon
    U Kosinska, C Carnrot, MPB Sandrini - FEBS , 2007 - Wiley Online Library
     
    9. Comparative molecular field analysis and comparative molecular similarity indices analysis of boron-containing human thymidine kinase 1 substrates
    AK Bandyopadhyaya, R Tiwari, W Tjarks - Bioorganic & medicinal , 2006 - Elsevier
     
    10. Carboranyl thymidine analogues for neutron capture therapy
    W Tjarks, R Tiwari, Y Byun, S Narayanasamy - Chem. Commun , 2007 - xlink.rsc.org
     
    11. Structural studies of salvage enzymes in nucleotide biosynthesis
    M Welin - 2007 - pub.epsilon.slu.se
     
    12. Salvage enzymes in nucleotide biosynthesis
    U Kosinska - 2007 - pub.epsilon.slu.se
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch