.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y7h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and biochemical studies identify tobacco SABP2 as a methyl salicylate esterase and implicate it in plant innate immunity. Proc.Natl.Acad.Sci.Usa 102 1773-1778 2005
    Site NESGC
    PDB Id 1y7h Target Id AR2241
    Related PDB Ids 1y7i 1xkl 
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS8724,PF00561, 3.40.50.1820 Molecular Weight 29302.22 Da.
    Residues 260 Isoelectric Point 5.39
    Sequence mkegkhfvlvhgachggwswyklkplleaaghkvtaldlaasgtdlrkieelrtlydytlplmelmesl sadekvilvghslggmnlglamekypqkiyaavflaafmpdsvhnssfvleqynertpaenwldtqflp ygspeepltsmffgpkflahklyqlcspedlalasslvrpsslfmedlskakyftderfgsvkrvyivc tedkgipeefqrwqidnigvteaieikgadhmamlcepqklcaslleiahkyn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.52 Rfree 0.297
    Matthews' coefficent 2.20 Rfactor 0.227
    Waters 224 Solvent Content 43.00

    Ligand Information
    Ligands SCN (THIOCYANATE) x 8
    Metals

    Jmol

     
    Google Scholar output for 1y7h
    1. Structural and biochemical studies identify tobacco SABP2 as a methyl salicylate esterase and implicate it in plant innate immunity
    F Forouhar, Y Yang, D Kumar, Y Chen - Proceedings of the , 2005 - National Acad Sciences
     
    2. Crystal structure of the restriction-modification system control element C. BclI and mapping of its binding site
    MR Sawaya, Z Zhu, F Mersha, S Chan, R Dabur, S Xu - Structure, 2005 - Elsevier
     
    3. Functional insights from structural genomics
    F Forouhar, A Kuzin, J Seetharaman, I Lee - Journal of structural and , 2007 - Springer
     
    4. The computational-based structure of Dwarf14 provides evidence for its role as potential strigolactone receptor in plants
    N Gaiji, F Cardinale, C Prandi, P Bonfante - BMC Research , 2012 - biomedcentral.com
     
    5. Computational Investigation on the Ethylene-induced Esterase from Citrus Sinensis
    WW Han, DL Zhan, X Zhao, S Wang - Chemical Research in Chinese , 2010 - cjcu.jlu.edu.cn
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch