.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ydl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Human TFIIH, Northeast Structural Genomics Target HR2045. To be Published
    Site NESGC
    PDB Id 1ydl Target Id HR2045
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8910,PF06331, 3.30.70.1220 Molecular Weight 7810.62 Da.
    Residues 69 Isoelectric Point 4.68
    Sequence gtrkgvliecdpamkqfllyldesnalgkkfiiqdiddthvfviaelvnvlqervgelmdqnafsltqk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.297
    Matthews' coefficent 2.20 Rfactor 0.236
    Waters 35 Solvent Content 50.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ydl
    1. Solution structure and self-association properties of the p8 TFIIH subunit responsible for trichothiodystrophy
    M Vitorino, F Coin, O Zlobinskaya, RA Atkinson - Journal of molecular , 2007 - Elsevier
     
    2. Structural basis for group A trichothiodystrophy
    DE Kainov, M Vitorino, J Cavarelli - Nature structural & , 2008 - nature.com
     
    3. Structure determination of the minimal complex between Tfb5 and Tfb2, two subunits of the yeast transcription/DNA-repair factor TFIIH: a retrospective study
    DE Kainov, V Cura, M Vitorino - Section D: Biological , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch