.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ydm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of Northeast Structural Genomics target SR44. To be Published
    Site NESGC
    PDB Id 1ydm Target Id SR44
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9097,PF01812, 3.40.50.10420 Molecular Weight 21412.61 Da.
    Residues 187 Isoelectric Point 5.85
    Sequence mksqlrkktlealsalsnedilqktermykylfslpewqnagtiavtisrgleiptrpvieqaweegkq vcipkchpdtkkmqfrtyqtddqletvyagllepviektkevnpsqidlmivpgvcfdvngfrvgfggg yydrylseyegktvslllecqlfahvprlphdipvhklitedriiscfs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.50 Rfree 0.304
    Matthews' coefficent 2.30 Rfactor 0.224
    Waters 57 Solvent Content 46.70

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 1ydm
    1. SPINE workshop on automated X-ray analysis: a progress report
    M Bahar, C Ballard, SX Cohen, KD Cowtan - Section D: Biological , 2006 - scripts.iucr.org
     
    2. Structure of 5-formyltetrahydrofolate cyclo-ligase from Bacillus anthracis (BA4489)
    C Meier, LG Carter, G Winter, RJ Owens - Section F: Structural , 2007 - scripts.iucr.org
     
    3. Investigations of the Roles of Arginine 115 and Lysine 120 in the Active Site of 5, 10-Methenyltetrahydrofolate Synthetase from Mycoplasma pneumoniae
    AN Hancock, RS Coleman, RT Johnson, CA Sarisky - The Protein , 2008 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch