.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ydn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of two bacterial 3-hydroxy-3-methylglutaryl-CoA lyases suggest a common catalytic mechanism among a family of TIM barrel metalloenzymes cleaving carbon-carbon bonds. J.Biol.Chem. 281 7533-7545 2006
    Site NESGC
    PDB Id 1ydn Target Id LR35
    Molecular Characteristics
    Source Brucella melitensis
    Alias Ids TPS8944,PF00682, 3.20.20.70 Molecular Weight 30251.65 Da.
    Residues 287 Isoelectric Point 5.10
    Sequence maehveivemaardglqnekrfvptadkialinrlsdcgyarieatsfvspkwvpqladsrevmagirr adgvrysvlvpnmkgyeaaaaahadeiavfisasegfskaninctiaesierlspvigaaindglairg yvscvvecpydgpvtpqavasvteqlfslgchevslgdtigrgtpdtvaamldavlaiapahslaghyh dtggraldnirvslekglrvfdasvgglggcpfapgakgnvdtvavvemlhemgfetgldldrlrsagl ftqalrqdkaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.304
    Matthews' coefficent 2.40 Rfactor 0.271
    Waters 596 Solvent Content 45.00

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 4

    Jmol

     
    Google Scholar output for 1ydn
    1. Strategies for high_throughput comparative modeling: Applications to leverage analysis in structural genomics and protein family organization
    N Mirkovic, Z Li, A Parnassa - : Structure, Function, and , 2007 - Wiley Online Library
     
    2. Molecular genetics of HMG-CoA lyase deficiency
    J Pi, E Lopez-Vinas, B Puisac, S Menao, A Pi - Molecular genetics and , 2007 - Elsevier
     
    3. Crystal structures of two bacterial 3-hydroxy-3-methylglutaryl-CoA lyases suggest a common catalytic mechanism among a family of TIM barrel metalloenzymes
    F Forouhar, M Hussain, R Farid, J Benach - Journal of Biological , 2006 - ASBMB
     
    4. C-Terminal end and aminoacid Lys 48 in HMG-CoA lyase are involved in substrate binding and enzyme activity
    P Carrasco, S Menao, E Lopez-Vinas - Molecular genetics and , 2007 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch