.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yez

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the conserved protein from the gene locus MM1357 of Methanosarcina mazei. Northeast Structural Genomics target MaR30. To be Published
    Site NESGC
    PDB Id 1yez Target Id MaR30
    Molecular Characteristics
    Source Methanosarcina mazei
    Alias Ids TPS8966,6505, PF01938 Molecular Weight 7611.32 Da.
    Residues 68 Isoelectric Point 4.78
    Sequence mfreesrsvpveegevydvtiqdiarqgdgiariegfvifvpgtkvgdevrikvervlpkfafasvve
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yez
    1. Evaluating protein structures determined by structural genomics consortia
    A Bhattacharya, R Tejero - : Structure, Function, and , 2007 - Wiley Online Library
     
    2. Structural bioinformatics analysis of enzymes involved in the biosynthesis pathway of the hypermodified nucleoside ms2io6A37 in tRNA
    KH Kaminska, U Baraniak, M Boniecki - Proteins: Structure, , 2008 - Wiley Online Library
     
    3. SPINS: a laboratory information management system for organizing and archiving intermediate and final results from NMR protein structure determinations
    MC Baran, HNB Moseley, JM Aramini - Proteins: Structure, , 2006 - Wiley Online Library
     
    4. Microcoil NMR spectroscopy: a novel tool for biological high throughput NMR spectroscopy
    RE Hopson, W Peti - METHODS IN MOLECULAR BIOLOGY-CLIFTON , 2008 - Springer
     
    5. Prediction of Protein Function from Theoretical Models
    IA Cymerman, DJ Rigden, JM Bujnicki - From Protein Structure to Function , 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch