.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ypx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative Vitamin-B12 Independent Methionine Synthase from Listeria monocytogenes, Northeast Structural Genomics Target LmR13. To be Published
    Site NESGC
    PDB Id 1ypx Target Id LmR13
    Molecular Characteristics
    Source Listeria monocytogenes
    Alias Ids TPS8951,3.20.20.210, PF01717 Molecular Weight 41803.86 Da.
    Residues 367 Isoelectric Point 4.95
    Sequence mnqvapfyadhvgsilrtkgikdarekfqsgeitalelrkienteikyivekqkevglksitdgefrra wwhfdflenldgvegydaaggiqfskvqtkshsvkitgpidftthpfiedfiflkeavgdnhvakqtip spamlhyrgdieyqpylddaekfandlatayqkaiqafydagcrylqlddtswsylcsdeqrevvrqrg fdpetlqetyknlineaikhkpadmvitmhicrgnfrstwiaeggygpvaetlfgklnidgffleydne rsgdfaplkyvtrpdlkivlglitsktgeledeaaikarieeaseivplsqlrlspqcgfasteegnil teeeqwdklryvvrlandiwge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.308
    Matthews' coefficent 2.20 Rfactor 0.233
    Waters 56 Solvent Content 43.00

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch