.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yud

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein SO0799 from Shewanella oneidensis. To be Published
    Site NESGC
    PDB Id 1yud Target Id SoR12
    Molecular Characteristics
    Source Shewanella oneidensis
    Alias Ids TPS9146,PF06172, 2.60.120.10 Molecular Weight 18163.60 Da.
    Residues 160 Isoelectric Point 4.87
    Sequence mqnaddfikfleleqhveggfyrssyrsetafdpsrqlwssiyfllrtgevshfhrltademwyfhagq sltiymispegelttaqlgldlaagerpqflvpkgcifgsamnqdgfslvgcmvspgftfddfelfsqe allamypqhkavvqklsrpevn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 2.70 Rfree 0.292
    Matthews' coefficent 2.60 Rfactor 0.237
    Waters 112 Solvent Content 53.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yud
    1. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    2. Identification, expression, function and localization of a DUF985 domain-containing hypothetical gene from amphioxus Branchiostoma belcheri
    S Gaowa, S Zhang - Comparative Biochemistry and Physiology Part B: , 2009 - Elsevier
     
    3. Crystal structures of the apo and GDP_bound forms of a cupin_like protein BbDUF985 from Branchiostoma belcheri tsingtauense
    Y Du, YX He, S Gaowa, X Zhang - Proteins: Structure, , 2010 - Wiley Online Library
     
    4. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch