.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yvc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title To be Published
    Site NESGC
    PDB Id 1yvc Target Id MrR5
    Molecular Characteristics
    Source Methanococcus maripaludis
    Alias Ids TPS8978,PF01938, 6574 Molecular Weight 7388.23 Da.
    Residues 69 Isoelectric Point 6.21
    Sequence mafgkpamknvpveagkeyevtiedmgkggdgiaridgfvvfvpnaekgsvinvkvtavkekfafaerv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yvc
    1. Structural bioinformatics analysis of enzymes involved in the biosynthesis pathway of the hypermodified nucleoside ms2io6A37 in tRNA
    KH Kaminska, U Baraniak, M Boniecki - Proteins: Structure, , 2008 - Wiley Online Library
     
    2. Fuzzy oil drop model applied to individual small proteins built of 70 amino acids
    K Prymula, K Sa_apa, I Roterman - Journal of molecular modeling, 2010 - Springer
     
    3. Prediction of Protein Function from Theoretical Models
    IA Cymerman, DJ Rigden, JM Bujnicki - From Protein Structure to Function , 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch