.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yvk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Bacillis subtilis Acetyltransferase in complex with CoA, Northeast Structural Genomics Target SR237. To be Published
    Site NESGC
    PDB Id 1yvk Target Id SR237
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9078,3.40.630.30, PF00583 Molecular Weight 17744.32 Da.
    Residues 155 Isoelectric Point 4.74
    Sequence mnmqklrielgeetndelydlllladpskdivdeylergecytawagdelagvyvllktrpqtveivni avkeslqkkgfgkqlvldaiekakklgadtieigtgnssihqlslyqkcgfriqaidhdfflrhydedi fengiqcrdmvrlyldl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 3.01 Rfree 0.284
    Matthews' coefficent 2.83 Rfactor 0.243
    Waters Solvent Content 55.00

    Ligand Information
    Ligands COA (COENZYME) x 4
    Metals

    Jmol

     
    Google Scholar output for 1yvk
    1. An extremely SAD case: structure of a putative redox-enzyme maturation protein from Archaeoglobus fulgidus at 3.4 A resolution
    O Kirillova, M Chruszcz, IA Shumilin - Section D: Biological , 2007 - scripts.iucr.org
     
    2. Improvements to the pseudospectral electronic structure method and experimental protein model initiation
    BH Greeley - 2006 - greeley.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch