.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yvw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Phosphoribosyl-ATP pyrophosphohydrolase from Bacillus cereus at 2.6 A resolution. To be Published
    Site NESGC
    PDB Id 1yvw Target Id BcR13
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS8746,PF03819, PF01503 Molecular Weight 12445.73 Da.
    Residues 107 Isoelectric Point 5.32
    Sequence menafkllyktieerkgsplpesytnylfskgedkilkkigeecaeviiacknndkeevvkemvdvfyh cfvllaeknialedvmrevkerngklsrvgdrreidtl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.60 Rfree 0.263
    Matthews' coefficent 2.00 Rfactor 0.244
    Waters 169 Solvent Content 38.51

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yvw
    1. Dimeric dUTPases, HisE, and MazG belong to a New Superfamily of all-_ NTP Pyrophosphohydrolases with Potential House-cleaning Functions
    OV Moroz, AG Murzin, KS Makarova, EV Koonin - Journal of molecular , 2005 - Elsevier
     
    2. De-orphaning the structural proteome through reciprocal comparison of evolutionarily important structural features
    RM Ward, S Erdin, TA Tran, DM Kristensen - PloS one, 2008 - dx.plos.org
     
    3. Molecular cloning and characterization of gene encoding for cytoplasmic Hsc70 from Pennisetum glaucum may play a protective role against abiotic stresses
    PS Reddy, G Mallikarjuna, T Kaul - Molecular Genetics and , 2010 - Springer
     
    4. The 1.25 A resolution structure of phosphoribosyl-ATP pyrophosphohydrolase from Mycobacterium tuberculosis
    F Javid-Majd, D Yang, TR Ioerger - Section D: Biological , 2008 - scripts.iucr.org
     
    5. Structure of a putative NTP pyrophosphohydrolase: YP_001813558. 1 from Exiguobacterium sibiricum 255-15
    GW Han, MA Elsliger, TO Yeates, Q Xu - Section F: Structural , 2010 - scripts.iucr.org
     
    6. MODELING PROTEIN INTERACTIONS THROUGH STRUCTURE ALIGNMENT
    R Sinha - 2011 - kuscholarworks.ku.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch