.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yw0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the tryptophan 2,3-dioxygenase from Xanthomonas campestris. Northeast Structural Genomics Target XcR13. To be Published
    Site NESGC
    PDB Id 1yw0 Target Id XcR13
    Related PDB Ids 2nw9 2nw8 2nw7 
    Molecular Characteristics
    Source Xanthomonas campestris
    Alias Ids TPS9251,PF03301 Molecular Weight 34615.60 Da.
    Residues 298 Isoelectric Point 6.16
    Sequence mpvdknlrdlepgihtdlegrltyggylrldqllsaqqplsepahhdemlfiiqhqtselwlkllahel raaivhlqrdevwqcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgfqslqyryiefll gnknpqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvaddtlrpvfe riyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfkrgtggssgvgflqqalaltffpelf dvrtsvgvdnrppqgsadagkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.70 Rfree 0.294
    Matthews' coefficent 2.85 Rfactor 0.25
    Waters 105 Solvent Content 56.85

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 8

    Jmol

     
    Google Scholar output for 1yw0
    1. Molecular insights into substrate recognition and catalysis by tryptophan 2, 3-dioxygenase
    F Forouhar, JL Anderson, CG Mowat - Proceedings of the , 2007 - National Acad Sciences
     
    2. Crystal structure and mechanism of tryptophan 2, 3-dioxygenase, a heme enzyme involved in tryptophan catabolism and in quinolinate biosynthesis
    Y Zhang, SA Kang, T Mukherjee, S Bale, BR Crane - Biochemistry, 2007 - ACS Publications
     
    3. Histidine 55 of Tryptophan 2, 3-Dioxygenase Is Not an Active Site Base but Regulates Catalysis by Controlling Substrate Binding
    SJ Thackray, C Bruckmann, JLR Anderson - Biochemistry, 2008 - ACS Publications
     
    4. Oxidation of L-tryptophan in biology: a comparison between tryptophan 2, 3-dioxygenase and indoleamine 2, 3-dioxygenase
    SA Rafice, N Chauhan, I Efimov - Biochemical Society , 2009 - www-06.all-portland.net
     
    5. 3D-Fun: predicting enzyme function from structure
    M Von Grotthuss, D Plewczynski, G Vriend - Nucleic Acids , 2008 - Oxford Univ Press
     
    6. Synthesis, crystal structures and electronic properties of isomers of chloro-pyridinylvinyl-1 H-indoles
    L Moineaux, S Laurent, J Reniers, E Dolui_ - European Journal of , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch