.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yw3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative Nitroreductase in Complex with FMN from Streptococcus mutans, Northeast Structural Genomics Target SmR5. To be Published
    Site NESGC
    PDB Id 1yw3 Target Id SmR5
    Related PDB Ids 2ifa 
    Molecular Characteristics
    Source Streptococcus mutans
    Alias Ids TPS9142,3.40.109.10 Molecular Weight 22383.17 Da.
    Residues 200 Isoelectric Point 4.94
    Sequence msnfldlqkqrrsiyalgktvdlskaelvaliqnaikqapsafnsqtsralvlfgqdsqdfwnkiaysel ekvtpaeafagtkaklesfaagvgtillfedqavvrnleenfplyaenfqpwseqahgialyaiwlala eqnigmsvqhynplvdaqvaekydlptnwkmraqipfgsieapagekefmadqerfkvfgd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.30 Rfree 0.278
    Matthews' coefficent 2.40 Rfactor 0.223
    Waters 435 Solvent Content 48.00

    Ligand Information
    Ligands FMN (FLAVIN) x 6
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch