.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yw4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Succinylglutamate Desuccinylase from Chromobacterium violaceum, Northeast Structural Genomics Target CvR22. To be Published
    Site NESGC
    PDB Id 1yw4 Target Id CvR22
    Molecular Characteristics
    Source Chromobacterium violaceum
    Alias Ids TPS8807,PF04952, 3.40.630.10 Molecular Weight 36518.38 Da.
    Residues 333 Isoelectric Point 5.89
    Sequence mthspsflqhalsssdtraewplpgglaarwlapgcvelngdargadsvllscgvhgnetapievvdgm ltdiaagqlalncrllvmfanldairqgvrygnydmnrlfngaharhpelpesvraaeletlaaeffag ararklhydlhtairgsvfekfaiypflhdgrthkreqlawlqrcgieavllhtqpantfsyftsqyce adaftlelgkarpfgqndlsrfsgidgalrgllsnpqanvpdldedklplfrakydlvkhseafklnla dsvenftllpdgmliaedgavryqatggeerilfpnpavkpglragivveparlpsr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.262
    Matthews' coefficent 2.22 Rfactor 0.221
    Waters 422 Solvent Content 44.00

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 1yw4
    1. Identification of the zinc binding ligands and the catalytic residue in human aspartoacylase, an enzyme involved in Canavan disease
    S Herga, JG Berrin, J Perrier, A Puigserver, T Giardina - FEBS letters, 2006 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch