The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Succinylglutamate Desuccinylase from Escherichia coli, Northeast Structural Genomics Target ET72. To be Published
    Site NESGC
    PDB Id 1yw6 Target Id ET72
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8871,PF04952, 3.40.630.10 Molecular Weight 35798.27 Da.
    Residues 322 Isoelectric Point 6.06
    Sequence mdnflaltltgkkpvitereingvrwrwlgdgvleltpltppqgalvisagihgnetapvemldallga ishgeiplrwrllvilgnppalkqgkrychsdmnrmfggrwqlfaesgetcrareleqcledfydqgke svrwhldlhtairgslhpqfgvlpqrdipwdekfltwlgaaglealvfhqepggtfthfsarhfgalac tlelgkalpfgqndlrqfavtasaiaallsgesvgivrtpplryrvvsqitrhspsfemhmasdtlnfm pfekgtllaqdgeerftvthdveyvlfpnplvalglraglmlekis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.10 Rfree 0.289
    Matthews' coefficent 3.94 Rfactor 0.227
    Waters 114 Solvent Content 68.00

    Ligand Information
    Ligands SO4 (SULFATE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch