.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ywl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the protein EF2693 from E. faecalis: Northeast Structural Genomics Consortium target EFR36. To be Published
    Site NESGC
    PDB Id 1ywl Target Id EfR36
    Molecular Characteristics
    Source Enterococcus faecalis
    Alias Ids TPS8880,PF01541 Molecular Weight 10408.38 Da.
    Residues 88 Isoelectric Point 9.75
    Sequence menkkshyfyvllcqdgsfyggytteperrltehnsgtgakytrlakrrpvimihtekfetrseatkae aafkkltrkqkeqylktfh
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ywl
    1. Phylogenomic analysis of the GIY-YIG nuclease superfamily
    S Dunin-Horkawicz, M Feder, JM Bujnicki - BMC genomics, 2006 - biomedcentral.com
     
    2. Folding, DNA recognition, and function of GIY-YIG endonucleases: crystal structures of R. Eco29kI
    ANS Mak, AR Lambert, BL Stoddard - Structure, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch