.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yws

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of YBL071w-A from Saccharomyces cerevisiae. To be published
    Site NESGC
    PDB Id 1yws Target Id YT655
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS9263,PF05207, 6555 Molecular Weight 9355.96 Da.
    Residues 82 Isoelectric Point 3.72
    Sequence mstydeieiedmtfepenqmftypcpcgdrfqiylddmfegekvavcpscslmidvvfdkedlaeyyee agihppepiaaaa
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 1yws
    1. Biochemical and Structural Characterization of a Novel Family of Cystathionine [beta]-Synthase Domain Proteins Fused to a Zn Ribbon-Like Domain
    M Proudfoot, SA Sanders, A Singer, R Zhang - Journal of molecular , 2008 - Elsevier
     
    2. Solution structure of human DESR1, a CSL zinc_binding protein
    F Wu, J Zhang, J Sun, H Huang, P Ji - Proteins: Structure, , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch