.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ywu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure and binding studies confirm that PA4608 from Pseudomonas aeruginosa is a PilZ domain and a c-di-GMP binding protein. Proteins 66 266-271 2007
    Site NESGC
    PDB Id 1ywu Target Id PaT7
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS9008,PF07238, 2.40.10.220, 6514 Molecular Weight 14572.59 Da.
    Residues 125 Isoelectric Point 4.78
    Sequence msdqhderrrfhriafdadseilqgerrwevllhdvslhgilvgqpqdwngdpqrpfearlylgldvli rmeislawardgllgfecqhidldsishlrrlvelnlgdeellerelallvsahdd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ywu
    1. PilZ domain is part of the bacterial c-di-GMP binding protein
    D Amikam, MY Galperin - Bioinformatics, 2006 - Oxford Univ Press
     
    2. DgrA is a member of a new family of cyclic diguanosine monophosphate receptors and controls flagellar motor function in Caulobacter crescentus
    M Christen, B Christen, MG Allan - Proceedings of the , 2007 - National Acad Sciences
     
    3. The structural basis of cyclic diguanylate signal transduction by PilZ domains
    J Benach, SS Swaminathan, R Tamayo - The EMBO , 2007 - nature.com
     
    4. Diversity of structure and function of response regulator output domains
    MY Galperin - Current opinion in microbiology, 2010 - Elsevier
     
    5. NMR structure and binding studies confirm that PA4608 from Pseudomonas aeruginosa is a PilZ domain and ac_di_GMP binding protein
    TA Ramelot, A Yee, JR Cort, A Semesi - Proteins: Structure, , 2007 - Wiley Online Library
     
    6. Alg44, a unique protein required for alginate biosynthesis in Pseudomonas aeruginosa
    U Remminghorst, BHA Rehm - FEBS letters, 2006 - Elsevier
     
    7. PILZ protein structure and interactions with PILB and the FIMX EAL domain: implications for control of type IV pilus biogenesis
    CR Guzzo, RK Salinas, MO Andrade - Journal of molecular , 2009 - Elsevier
     
    8. Conserved structural determinants in three_fingered protein domains
    A Galat, G Gross, P Drevet, A Sato, A Mnez - FEBS Journal, 2008 - Wiley Online Library
     
    9. Solution Structure of the PilZ Domain Protein PA4608 Complex with Cyclic di-GMP Identifies Charge Clustering as Molecular Readout
    J Habazettl, MG Allan, U Jenal, S Grzesiek - Journal of Biological Chemistry, 2011 - ASBMB
     
    10. XC1028 from Xanthomonas campestris adopts a PilZ domain_like structure without ac_di_GMP switch
    TN Li, KH Chin, JH Liu, AHJ Wang - Structure, Function, and , 2009 - Wiley Online Library
     
    11. Structural characterization reveals that a PilZ domain protein undergoes substantial conformational change upon binding to cyclic dimeric guanosine monophosphate
    JS Shin, KS Ryu, J Ko, A Lee, BS Choi - Protein Science, 2011 - Wiley Online Library
     
    12. A Novel Tetrameric PilZ Domain Structure from Xanthomonads
    TN Li, KH Chin, KM Fung, MT Yang, AHJ Wang - PloS one, 2011 - dx.plos.org
     
    13. Principles of c-di-GMP signaling: characterization of a second messenger system orchestrating bacterial life style
    B Christen - 2007 - edoc.unibas.ch
     
    14. Top (Index), File: 18034161. pdf
    C Sensitive, J Benach - The EMBO , 2007 - www-tsujii.is.su-tokyo.ac.jp
     
    15. XC6012 from Xanthomonas campestris Adopts a Novel Tetrameric PilZ Domain Structure Stabilized by a Central Parallel Four-Stranded Coiled-Coil
    TN Li, KH Chin, HJW Andrew - __________, 2009 - research.nchu.edu.tw
     
    16. Sensing the messenger: The diverse ways that bacteria signal through c_di_GMP
    PV Krasteva, KM Giglio, H Sondermann - Protein Science, 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch