.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ywx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of Methanococcus maripaludis Protein MMP0443: The Northeast Structural Genomics Consortium Target MrR16. To be Published
    Site NESGC
    PDB Id 1ywx Target Id MrR16
    Molecular Characteristics
    Source Methanococcus maripaludis
    Alias Ids TPS8977,6799, PF01282, 3.30.70.330 Molecular Weight 11457.49 Da.
    Residues 102 Isoelectric Point 4.75
    Sequence mdisiisdrnnpllqrreikftvsfdaatpsikdvkmklvavlnankqvlvvdtldqifgkleaegyak iyndekamatietksvleknkieeeaeaevaee
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ywx
    1. Protein backbone chemical shifts predicted from searching a database for torsion angle and sequence homology
    Y Shen, A Bax - Journal of biomolecular NMR, 2007 - Springer
     
    2. De novo protein structure generation from incomplete chemical shift assignments
    Y Shen, R Vernon, D Baker, A Bax - Journal of biomolecular NMR, 2009 - Springer
     
    3. Comparisons of NMR spectral quality and success in crystallization demonstrate that NMR and X-ray crystallography are complementary methods for small protein
    DA Snyder, Y Chen, NG Denissova - Journal of the , 2005 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch