The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of Bacillus subtilis Protein ysnE. To be Published
    Site NESGC
    PDB Id 1yx0 Target Id SR220
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9077,3.40.630.30, PF00583, PF08445, 6793 Molecular Weight 17051.53 Da.
    Residues 151 Isoelectric Point 5.80
    Sequence mhikiddltgrqvvslvnehlhsmtlmsppesihalgleklrgpeitfwsawegdelagcgalkeldtr hgeiksmrtsashlrkgvakqvlqhiieeaekrgyerlsletgsmasfeparklyesfgfqycepfady gedpnsvfmtkkl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch