.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yx3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Allochromatium vinosum DsrC: solution-state NMR structure, redox properties, and interaction with DsrEFH, a protein essential for purple sulfur bacterial sulfur oxidation. J.Mol.Biol. 382 692-707 2008
    Site NESGC
    PDB Id 1yx3 Target Id OP4
    Molecular Characteristics
    Source Other
    Alias Ids TPS8993,1.10.10.370, 3.30.1420.10, 6518, PF04358 Molecular Weight 12605.70 Da.
    Residues 112 Isoelectric Point 4.97
    Sequence madtievdgkqfavdeegylsnlndwvpgvadvmakqdnlelteehwdiinflreyyeeyqiapavrvl tkavgkklgkekgnskylyslfpygpakqacrfaglpkptgcv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yx3
    1. The crystal structure of Desulfovibrio vulgaris dissimilatory sulfite reductase bound to DsrC provides novel insights into the mechanism of sulfate respiration
    TF Oliveira, C Vonrhein, PM Matias - Journal of Biological , 2008 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch