.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yxb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Phosphoribosyl-ATP pyrophosphatase from Streptomyces coelicolor. NESG target RR8. To be Published
    Site NESGC
    PDB Id 1yxb Target Id RR8
    Molecular Characteristics
    Source Streptomyces coelicolor
    Alias Ids TPS9043,PF01503 Molecular Weight 9918.74 Da.
    Residues 90 Isoelectric Point 4.93
    Sequence mskktfeelftelqhkaangdpatsrtaelvdkgvhaigkkvveeaaevwmaaeyegkdaaaeeisqll yhvqvmmvargislddvyahl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.60 Rfree 0.295
    Matthews' coefficent 2.27 Rfactor 0.25
    Waters 235 Solvent Content 45.34

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yxb
    1. Dimeric dUTPases, HisE, and MazG belong to a New Superfamily of all-_ NTP Pyrophosphohydrolases with Potential House-cleaning Functions
    OV Moroz, AG Murzin, KS Makarova, EV Koonin - Journal of molecular , 2005 - Elsevier
     
    2. The 1.25 A resolution structure of phosphoribosyl-ATP pyrophosphohydrolase from Mycobacterium tuberculosis
    F Javid-Majd, D Yang, TR Ioerger - Section D: Biological , 2008 - scripts.iucr.org
     
    3. Structure of a putative NTP pyrophosphohydrolase: YP_001813558. 1 from Exiguobacterium sibiricum 255-15
    GW Han, MA Elsliger, TO Yeates, Q Xu - Section F: Structural , 2010 - scripts.iucr.org
     
    4. Comparative domain modeling of human EGF-like module EMR2 and study of interaction of the fourth domain of EGF with chondroitin 4-sulphate
    M Rani, MR Dikhit, GC Sahoo, P Das - Journal of Biomedical Research, 2011 - Elsevier
     
    5. Improvements to the pseudospectral electronic structure method and experimental protein model initiation
    BH Greeley - 2006 - greeley.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch