.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zbp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Functional insights from structural genomics. J.STRUCT.FUNCT.GENOM. 8 37-44 2007
    Site NESGC
    PDB Id 1zbp Target Id VpR44
    Molecular Characteristics
    Source Vibrio parahaemolyticus
    Alias Ids TPS9241,PF07024, 1.25.40.10 Molecular Weight 29496.80 Da.
    Residues 265 Isoelectric Point 4.46
    Sequence mtqwknalsegqlqqalellieaikaspkdaslrssfiellcidgdferadeqlmqsiklfpeylpgas qlrhlvkaaqarkdfaqgaatakvlgeneeltkslvsfnlsmvsqdyeqvselalqieelrqekgflan dtsfsdvrdiddrlggyielfstagnyflvpiasintleiksatsllesvwrpvefdidglgegeghmp mtyvdsesdaqklgretdwkqiadkevylglglkcwlvgemalpisdlqnlqvikela
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.292
    Matthews' coefficent 3.23 Rfactor 0.239
    Waters 44 Solvent Content 61.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zbp
    1. Functional insights from structural genomics
    F Forouhar, A Kuzin, J Seetharaman, I Lee - Journal of structural and , 2007 - Springer
     
    2. Generalized Fragment Picking in Rosetta: Design, Protocols and Applications
    D Gront, DW Kulp, RM Vernon, CEM Strauss, D Baker - PloS one, 2011 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch