.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zbr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative Arginine Deiminase from Porphyromonas gingivalis, Northeast Structural Genomics Target PgR3. To be Published
    Site NESGC
    PDB Id 1zbr Target Id PgR3
    Molecular Characteristics
    Source Porphyromonas gingivalis
    Alias Ids TPS9025,3.75.10.10, PF04371 Molecular Weight 38296.56 Da.
    Residues 341 Isoelectric Point 5.34
    Sequence mtkrlflpewapqeavqltwphdrtdwaymldevetcfvriatailrherlivvcpdrkrvfgllppel hhrlycfelpsndtwardhggislladgrpmiadfafngwgmkfaahhdnlitrrlhalglfaegvtld nrlafvleggaletdgegtllttdsclfepnrnaglsrtaiidtlkeslgvsrvlslrhgalagddtdg hidtlarfvdtrtivyvrsedpsdehysdltameqelkelrrpdgqpyrlvplpmaealydgadrlpat yanfliingavlvptydshldavalsvmqglfpdrevigidcrplvkqhgslhcvtmqypqgfir
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.289
    Matthews' coefficent 2.10 Rfactor 0.21
    Waters 144 Solvent Content 40.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch