.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zbs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Putative N-acetylglucosamine Kinase (PG1100) from Porphyromonas gingivalis, Northeast Structural Genomics Target PgR18. To be Published
    Site NESGC
    PDB Id 1zbs Target Id PgR18
    Molecular Characteristics
    Source Porphyromonas gingivalis
    Alias Ids TPS9023,PF01869 Molecular Weight 30743.47 Da.
    Residues 283 Isoelectric Point 5.98
    Sequence miligdsgstktdwciakegkslgrfqtsginpfqqdrneidtalrsevlpaigqkassiravyfygag ctpakapmlnealdsmlphcdrievagdmlgaaralcgdsegiacilgtgsnsclfdgreikanvsplg yilgdegsgavlgrlfigsllkgqmpeglceaflqeygltsadiiesvyrkpfpnrflagfspfiaqhl dipavyslvqnsfddflvrnvlrynrpdlplhfigsvafhyrevlssvikkrgltlgsvlqspmegliq yhhnnhv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.289
    Matthews' coefficent 3.10 Rfactor 0.231
    Waters 115 Solvent Content 59.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zbs
    1. Automatic procedure for using models of proteins in molecular replacement
    D Raimondo, A Giorgetti, S Bosi - PROTEINS: Structure, , 2007 - Wiley Online Library
     
    2. Structures of human N-acetylglucosamine kinase in two complexes with N-acetylglucosamine and with ADP/glucose: insights into substrate specificity and regulation
    WA Weihofen, M Berger, H Chen, W Saenger - Journal of molecular , 2006 - Elsevier
     
    3. Characterization of an N-acetylmuramic acid/N-acetylglucosamine kinase of Clostridium acetobutylicum
    J Reith, A Berking, C Mayer - Journal of bacteriology, 2011 - Am Soc Microbiol
     
    4. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch