.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zc6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative N-acetylglucosamine Kinase from Chromobacterium violaceum. To be Published
    Site NESGC
    PDB Id 1zc6 Target Id CvR23
    Molecular Characteristics
    Source Chromobacterium violaceum
    Alias Ids TPS8808,PF01869, 3.30.420.40 Molecular Weight 30725.82 Da.
    Residues 297 Isoelectric Point 5.85
    Sequence marqtmnpsiryligvdgggtgtrirlhasdgtplamaeggasalsqgiakswqavlstleaafqqagl paapasacaiglglsgvhnrqwagefesqapgfarlslatdgyttllgahggqpgiivalgtgsigeal ypdgshreaggwgypsgdeasgawlgqraaqltqmaldgrhshspltravldfvggdwqammawngrat paqfarlaplvlsaarvdpeadallrqagedawaiaraldpqdelpvalcgglgqalrdwlppgfrqrl vapqgdsaqgallllqrpstr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.267
    Matthews' coefficent 3.64 Rfactor 0.241
    Waters 84 Solvent Content 66.22

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zc6
    1. Structures of human N-acetylglucosamine kinase in two complexes with N-acetylglucosamine and with ADP/glucose: insights into substrate specificity and regulation
    WA Weihofen, M Berger, H Chen, W Saenger - Journal of molecular , 2006 - Elsevier
     
    2. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    3. Characterization of an N-acetylmuramic acid/N-acetylglucosamine kinase of Clostridium acetobutylicum
    J Reith, A Berking, C Mayer - Journal of bacteriology, 2011 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch