.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zce

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics reveals EVE as a new ASCH/PUA-related domain. Proteins 75 760-773 2009
    Site NESGC
    PDB Id 1zce Target Id AtR33
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS8731,3.10.590.10, PF01878 Molecular Weight 16663.20 Da.
    Residues 147 Isoelectric Point 5.28
    Sequence manywlyksepfkwswemqkakgetgeewtgvrnyqarnnmramkigdkgffyhsnegldvvgivevca lshpdstaegdlkwdcvdiravcdmpqpvslkdvkanpklekmslvtsmrlsvqpvteeeylevcrmgg lanppkspd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.211
    Matthews' coefficent 2.10 Rfactor 0.195
    Waters 319 Solvent Content 40.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zce
    1. Structure of Lmaj006129AAA, a hypothetical protein from Leishmania major
    T Arakaki, I Le Trong, E Phizicky, E Quartley - Section F: Structural , 2006 - scripts.iucr.org
     
    2. The ASCH superfamily: novel domains with a fold related to the PUA domain and a potential role in RNA metabolism
    LM Iyer, AM Burroughs, L Aravind - Bioinformatics, 2006 - Oxford Univ Press
     
    3. Determining the DUF55-domain structure of human thymocyte nuclear protein 1 from crystals partially twinned by tetartohedry
    F Yu, A Song, C Xu, L Sun, J Li, L Tang - Section D: Biological , 2009 - scripts.iucr.org
     
    4. The YTH domain is a novel RNA binding domain
    Z Zhang, D Theler, KH Kaminska, M Hiller - Journal of Biological , 2010 - ASBMB
     
    5. Structural genomics reveals EVE as a new ASCH/PUA_related domain
    C Bertonati, M Punta, M Fischer - Proteins: Structure, , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch